PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G386276_P01
Common NameHDZIV9_OCL9, Zm.158742
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 701aa    MW: 76970.4 Da    PI: 7.9934
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G386276_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-17115166556
                        SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        ++ t++qle+Le +F  + +p+ ++r++L++++gL+  qVk+WFqN+R+  k
  GRMZM2G386276_P01 115 HRVTSQQLEILEGFFSICAHPDDSQRKQLSESTGLSVHQVKFWFQNKRTHVK 166
                        5789********************************************9876 PP

2START97.23.1e-312814962206
                        HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S...... CS
              START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla...... 77 
                        lae aaqel+ +a+ e+p+W  ++    e +n   + q+f+  +        ++ea rasgvv  ++  lve l+d    + ++++      
  GRMZM2G386276_P01 281 LAENAAQELLVLADPESPLWLPVPggsfETLNMIAYAQTFPG-QMsvdaiaLKTEATRASGVVMLDPKSLVEFLMDAE-SYGTMFPglvsga 370
                        6899************************************55.5559*********************9999999999.*******999655 PP

                        ......EEEEEEEECTT.........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEE CS
              START  78 ......kaetlevissg.........galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgil 153
                                                  ga+q m+ el+++splv+ R+ +fvR++++l++g +++vdvS+d          ++R+++ pSg+l
  GRMZM2G386276_P01 371 atdkvyN---------WptsreesydGAVQMMTVELAFPSPLVAaRKCTFVRCCKKLEQGAFAVVDVSLDD---------GARCRKMPSGML 444
                        5444333.........3444466666****************************************99984.........479********* PP

                        EEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 154 iepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        i+p   + +kv  ++hv +++ ++h ++++ + sg+ +ga++wv  + rqc++
  GRMZM2G386276_P01 445 IQPIRYNSCKVSAIDHVRVDDTSIHDIFHPCL-SGVLFGARRWVTSMARQCAR 496
                        ******************************98.6999**************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-1795162IPR009057Homeodomain-like
SuperFamilySSF466891.42E-16105168IPR009057Homeodomain-like
PROSITE profilePS5007114.576108168IPR001356Homeobox domain
SMARTSM003898.3E-14110172IPR001356Homeobox domain
PfamPF000462.8E-15115166IPR001356Homeobox domain
CDDcd000864.13E-14118167No hitNo description
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PROSITE profilePS5084822.521271499IPR002913START domain
SuperFamilySSF559612.2E-21274496No hitNo description
CDDcd088757.71E-78276495No hitNo description
SMARTSM002341.2E-12280496IPR002913START domain
PfamPF018524.4E-22281496IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MKRDESSGGE PSFIEPTSGM DDPTLMGSLG GIDGPSLMEP FGRVGGGTSS QTSDIPENGS  60
SNQSVEAHAN NGKRESPGDG AARINEVNSS TAVKKKKKRS DRQQQDGPQP KKLLHRVTSQ  120
QLEILEGFFS ICAHPDDSQR KQLSESTGLS VHQVKFWFQN KRTHVKHLSG REENYRLKVE  180
NEMLKEENNR LIRQAQSNAP APAPAPCPRC INDAGHLLLE KEVERLKALN QMLQQELQLQ  240
GTEGETPVAV DPASGAFHPD PEPSLENVFA AQHDGQMLAK LAENAAQELL VLADPESPLW  300
LPVPGGSFET LNMIAYAQTF PGQMSVDAIA LKTEATRASG VVMLDPKSLV EFLMDAESYG  360
TMFPGLVSGA ATDKVYNWPT SREESYDGAV QMMTVELAFP SPLVAARKCT FVRCCKKLEQ  420
GAFAVVDVSL DDGARCRKMP SGMLIQPIRY NSCKVSAIDH VRVDDTSIHD IFHPCLSGVL  480
FGARRWVTSM ARQCARIRDV FHVTNCTLNV TSRGRKTIMK LADNLLADYT SSVAAFPDDA  540
WTVQCGVGTE QDIKIMYKRQ SEGSSSSSNT AVVCACASFL LPLRMRKAFD LLKNNLLRAK  600
VLVSLRPQGH MAWQQHDPLP IVMGGVAVGR TGERRLREGG GSCRQWCRKR RRCLHPACQA  660
WPRGKQGHHD DPAEQQLRRV RVVHGLLLSR QAAGGDNYEP G
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1647651RKRRR
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G386276
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G386276_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008674944.10.0PREDICTED: homeobox-leucine zipper protein TF1
TrEMBLG2J5S30.0G2J5S3_MAIZE; Homeodomain leucine zipper family IV protein
STRINGGRMZM2G386276_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Representative plantOGRP1438133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-86protodermal factor 2
Publications ? help Back to Top
  1. Javelle M, et al.
    Genome-wide characterization of the HD-ZIP IV transcription factor family in maize: preferential expression in the epidermis.
    Plant Physiol., 2011. 157(2): p. 790-803
    [PMID:21825105]